PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A00517.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family CO-like
Protein Properties Length: 466aa    MW: 49108.5 Da    PI: 9.788
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A00517.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.89.1e-08174219342
        zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                      ++C+ +e+ ++   C+ +   lC+ C   +H        H++vp+
  Pahal.A00517.1 174 VWVCEVCERAPAAVTCRADAAALCAACDADIHDAnplarrHERVPV 219
                     689*****************************44788888999986 PP

2CCT70.15.6e-24373417145
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                     Rea+l+RY+eKrk+R+FeK+irY+sRKa+AesRpRvKGrF+k+ae
  Pahal.A00517.1 373 REARLMRYREKRKNRRFEKTIRYASRKAYAESRPRVKGRFAKRAE 417
                     9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.0038132176IPR000315B-box-type zinc finger
CDDcd000212.45E-4135176No hitNo description
PROSITE profilePS5011910.865172219IPR000315B-box-type zinc finger
PfamPF006431.1E-5173219IPR000315B-box-type zinc finger
SMARTSM003367.9E-9177219IPR000315B-box-type zinc finger
PROSITE profilePS5101716.986373415IPR010402CCT domain
PfamPF062037.8E-18373415IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MTRRRHVGPH RPINPRDQHF AHFRLARGGP RVPPSPRHRR RPMAHHHLYP RPSPIRPAWT  60
NAPAPTQEEI PFPYKARNSR GLLPASLSLL VNPAISGKQL SRLSSVAGAG WGARRGGGDR  120
MEVGLVTRYW GVGGRLCGAC GGSPAAVHCR TCPGGAYLCA GCDAGHAPAG HERVWVCEVC  180
ERAPAAVTCR ADAAALCAAC DADIHDANPL ARRHERVPVQ PIGAAAPADP LLFADVMDPF  240
LGQDFARFPH ADSVVPNNGS SGRALDLDFG GAAAAAVVAK PSYSSYTAAS LGHSGSSSEV  300
GLVPDAICGR GGSVTGGVIE LDFAQSKAAY LPYVATPTHS VSSLDAGAVP DRSDGGVMAG  360
RVAATAPAAA ESREARLMRY REKRKNRRFE KTIRYASRKA YAESRPRVKG RFAKRAEDND  420
ADADAEAAGF PREAAAAAPP KQPQPAAYHP YVLDFAAGYG VVPTF*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1096301e-55AK109630.1 Oryza sativa Japonica Group cDNA clone:002-138-D02, full insert sequence.
GenBankAP0048381e-55AP004838.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0504A05.
GenBankAP0149581e-55AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951711.11e-152PREDICTED: zinc finger protein CONSTANS-LIKE 5-like
TrEMBLK3YT921e-152K3YT92_SETIT; Uncharacterized protein
STRINGSi017487m1e-151(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.16e-29CONSTANS-like 5